Protein Description: EFR3 homolog B
Gene Name: EFR3B
Alternative Gene Name: FLJ37871, KIAA0953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020658: 99%, ENSRNOG00000012950: 99%
Entrez Gene ID: 22979
Uniprot ID: Q9Y2G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EFR3B
Alternative Gene Name: FLJ37871, KIAA0953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020658: 99%, ENSRNOG00000012950: 99%
Entrez Gene ID: 22979
Uniprot ID: Q9Y2G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL |
| Documents & Links for Anti EFR3B pAb (ATL-HPA071831) | |
| Datasheet | Anti EFR3B pAb (ATL-HPA071831) Datasheet (External Link) |
| Vendor Page | Anti EFR3B pAb (ATL-HPA071831) at Atlas |
| Documents & Links for Anti EFR3B pAb (ATL-HPA071831) | |
| Datasheet | Anti EFR3B pAb (ATL-HPA071831) Datasheet (External Link) |
| Vendor Page | Anti EFR3B pAb (ATL-HPA071831) |