Protein Description: ephrin-B1
Gene Name: EFNB1
Alternative Gene Name: CFNS, Elk-L, EPLG2, LERK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031217: 93%, ENSRNOG00000006877: 92%
Entrez Gene ID: 1947
Uniprot ID: P98172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EFNB1
Alternative Gene Name: CFNS, Elk-L, EPLG2, LERK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031217: 93%, ENSRNOG00000006877: 92%
Entrez Gene ID: 1947
Uniprot ID: P98172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGA |
| Documents & Links for Anti EFNB1 pAb (ATL-HPA067188) | |
| Datasheet | Anti EFNB1 pAb (ATL-HPA067188) Datasheet (External Link) |
| Vendor Page | Anti EFNB1 pAb (ATL-HPA067188) at Atlas |
| Documents & Links for Anti EFNB1 pAb (ATL-HPA067188) | |
| Datasheet | Anti EFNB1 pAb (ATL-HPA067188) Datasheet (External Link) |
| Vendor Page | Anti EFNB1 pAb (ATL-HPA067188) |