Description
Product Description
Protein Description: ephrin A2
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG |
Gene Sequence | PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG |
Gene ID - Mouse | ENSMUSG00000003070 |
Gene ID - Rat | ENSRNOG00000016203 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EFNA2 pAb (ATL-HPA067567) | |
Datasheet | Anti EFNA2 pAb (ATL-HPA067567) Datasheet (External Link) |
Vendor Page | Anti EFNA2 pAb (ATL-HPA067567) at Atlas Antibodies |
Documents & Links for Anti EFNA2 pAb (ATL-HPA067567) | |
Datasheet | Anti EFNA2 pAb (ATL-HPA067567) Datasheet (External Link) |
Vendor Page | Anti EFNA2 pAb (ATL-HPA067567) |