Anti EFNA2 pAb (ATL-HPA067567)

Atlas Antibodies

Catalog No: ATL-HPA067567-25

• 

Product Description

Protein Description: ephrin A2
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
• Gene Sequence: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
• Gene ID - Mouse: ENSMUSG00000003070
• Gene ID - Rat: ENSRNOG00000016203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.