Protein Description: ephrin A1
Gene Name: EFNA1
Alternative Gene Name: ECKLG, EPLG1, LERK1, TNFAIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027954: 82%, ENSRNOG00000020573: 85%
Entrez Gene ID: 1942
Uniprot ID: P20827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EFNA1
Alternative Gene Name: ECKLG, EPLG1, LERK1, TNFAIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027954: 82%, ENSRNOG00000020573: 85%
Entrez Gene ID: 1942
Uniprot ID: P20827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS |
| Documents & Links for Anti EFNA1 pAb (ATL-HPA069549) | |
| Datasheet | Anti EFNA1 pAb (ATL-HPA069549) Datasheet (External Link) |
| Vendor Page | Anti EFNA1 pAb (ATL-HPA069549) at Atlas |
| Documents & Links for Anti EFNA1 pAb (ATL-HPA069549) | |
| Datasheet | Anti EFNA1 pAb (ATL-HPA069549) Datasheet (External Link) |
| Vendor Page | Anti EFNA1 pAb (ATL-HPA069549) |