Anti EFCAB1 pAb (ATL-HPA069955)

Atlas Antibodies

Catalog No: ATL-HPA069955-25

• 

Product Description

Protein Description: EF-hand calcium binding domain 1
Gene Name: EFCAB1
Alternative Gene Name: FLJ11767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068617: 82%, ENSRNOG00000050091: 80%
Entrez Gene ID: 79645
Uniprot ID: Q9HAE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR
• Gene Sequence: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR
• Gene ID - Mouse: ENSMUSG00000068617
• Gene ID - Rat: ENSRNOG00000050091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.