Anti EFCAB1 pAb (ATL-HPA069955)

Catalog No:
ATL-HPA069955-25
$303.00

Description

Product Description

Protein Description: EF-hand calcium binding domain 1
Gene Name: EFCAB1
Alternative Gene Name: FLJ11767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068617: 82%, ENSRNOG00000050091: 80%
Entrez Gene ID: 79645
Uniprot ID: Q9HAE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR
Gene Sequence MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR
Gene ID - Mouse ENSMUSG00000068617
Gene ID - Rat ENSRNOG00000050091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EFCAB1 pAb (ATL-HPA069955)
Datasheet Anti EFCAB1 pAb (ATL-HPA069955) Datasheet (External Link)
Vendor Page Anti EFCAB1 pAb (ATL-HPA069955) at Atlas Antibodies

Documents & Links for Anti EFCAB1 pAb (ATL-HPA069955)
Datasheet Anti EFCAB1 pAb (ATL-HPA069955) Datasheet (External Link)
Vendor Page Anti EFCAB1 pAb (ATL-HPA069955)

Product Description

Protein Description: EF-hand calcium binding domain 1
Gene Name: EFCAB1
Alternative Gene Name: FLJ11767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068617: 82%, ENSRNOG00000050091: 80%
Entrez Gene ID: 79645
Uniprot ID: Q9HAE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR
Gene Sequence MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR
Gene ID - Mouse ENSMUSG00000068617
Gene ID - Rat ENSRNOG00000050091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EFCAB1 pAb (ATL-HPA069955)
Datasheet Anti EFCAB1 pAb (ATL-HPA069955) Datasheet (External Link)
Vendor Page Anti EFCAB1 pAb (ATL-HPA069955) at Atlas Antibodies

Documents & Links for Anti EFCAB1 pAb (ATL-HPA069955)
Datasheet Anti EFCAB1 pAb (ATL-HPA069955) Datasheet (External Link)
Vendor Page Anti EFCAB1 pAb (ATL-HPA069955)