Protein Description: EF-hand calcium binding domain 1
Gene Name: EFCAB1
Alternative Gene Name: FLJ11767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068617: 82%, ENSRNOG00000050091: 80%
Entrez Gene ID: 79645
Uniprot ID: Q9HAE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EFCAB1
Alternative Gene Name: FLJ11767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068617: 82%, ENSRNOG00000050091: 80%
Entrez Gene ID: 79645
Uniprot ID: Q9HAE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFR |
Documents & Links for Anti EFCAB1 pAb (ATL-HPA069955) | |
Datasheet | Anti EFCAB1 pAb (ATL-HPA069955) Datasheet (External Link) |
Vendor Page | Anti EFCAB1 pAb (ATL-HPA069955) at Atlas |
Documents & Links for Anti EFCAB1 pAb (ATL-HPA069955) | |
Datasheet | Anti EFCAB1 pAb (ATL-HPA069955) Datasheet (External Link) |
Vendor Page | Anti EFCAB1 pAb (ATL-HPA069955) |