Anti EEF2 pAb (ATL-HPA057351 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA057351-100

• 
• 

Product Description

Protein Description: eukaryotic translation elongation factor 2
Gene Name: EEF2
Alternative Gene Name: EEF-2, EF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034994: 99%, ENSRNOG00000020266: 99%
Entrez Gene ID: 1938
Uniprot ID: P13639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPV
• Gene Sequence: SKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPV
• Gene ID - Mouse: ENSMUSG00000034994
• Gene ID - Rat: ENSRNOG00000020266
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.