Description
Product Description
Protein Description: enhancer of mRNA decapping 3
Gene Name: EDC3
Alternative Gene Name: FLJ21128, hYjeF_N2-15q23, LSM16, YJDC, YJEFN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038957: 93%, ENSRNOG00000019579: 93%
Entrez Gene ID: 80153
Uniprot ID: Q96F86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EDC3
Alternative Gene Name: FLJ21128, hYjeF_N2-15q23, LSM16, YJDC, YJEFN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038957: 93%, ENSRNOG00000019579: 93%
Entrez Gene ID: 80153
Uniprot ID: Q96F86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE |
Gene Sequence | IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE |
Gene ID - Mouse | ENSMUSG00000038957 |
Gene ID - Rat | ENSRNOG00000019579 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EDC3 pAb (ATL-HPA066137) | |
Datasheet | Anti EDC3 pAb (ATL-HPA066137) Datasheet (External Link) |
Vendor Page | Anti EDC3 pAb (ATL-HPA066137) at Atlas Antibodies |
Documents & Links for Anti EDC3 pAb (ATL-HPA066137) | |
Datasheet | Anti EDC3 pAb (ATL-HPA066137) Datasheet (External Link) |
Vendor Page | Anti EDC3 pAb (ATL-HPA066137) |