Protein Description: extracellular matrix protein 1
Gene Name: ECM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028108: 80%, ENSRNOG00000021166: 80%
Entrez Gene ID: 1893
Uniprot ID: Q16610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ECM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028108: 80%, ENSRNOG00000021166: 80%
Entrez Gene ID: 1893
Uniprot ID: Q16610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNR |
Documents & Links for Anti ECM1 pAb (ATL-HPA076029 w/enhanced validation) | |
Datasheet | Anti ECM1 pAb (ATL-HPA076029 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ECM1 pAb (ATL-HPA076029 w/enhanced validation) at Atlas |
Documents & Links for Anti ECM1 pAb (ATL-HPA076029 w/enhanced validation) | |
Datasheet | Anti ECM1 pAb (ATL-HPA076029 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ECM1 pAb (ATL-HPA076029 w/enhanced validation) |