Protein Description: endothelin converting enzyme like 1
Gene Name: ECEL1
Alternative Gene Name: DINE, XCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026247: 91%, ENSRNOG00000019447: 90%
Entrez Gene ID: 9427
Uniprot ID: O95672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ECEL1
Alternative Gene Name: DINE, XCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026247: 91%, ENSRNOG00000019447: 90%
Entrez Gene ID: 9427
Uniprot ID: O95672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR |
| Documents & Links for Anti ECEL1 pAb (ATL-HPA077424) | |
| Datasheet | Anti ECEL1 pAb (ATL-HPA077424) Datasheet (External Link) |
| Vendor Page | Anti ECEL1 pAb (ATL-HPA077424) at Atlas |
| Documents & Links for Anti ECEL1 pAb (ATL-HPA077424) | |
| Datasheet | Anti ECEL1 pAb (ATL-HPA077424) Datasheet (External Link) |
| Vendor Page | Anti ECEL1 pAb (ATL-HPA077424) |