Anti ECE2 pAb (ATL-HPA062215)

Atlas Antibodies

Catalog No: ATL-HPA062215-25

• 

Product Description

Protein Description: endothelin converting enzyme 2
Gene Name: ECE2
Alternative Gene Name: KIAA0604, MGC2408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022842: 88%, ENSRNOG00000029529: 87%
Entrez Gene ID: 9718
Uniprot ID: O60344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD
• Gene Sequence: REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD
• Gene ID - Mouse: ENSMUSG00000022842
• Gene ID - Rat: ENSRNOG00000029529
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.