Protein Description: endogenous Bornavirus-like nucleoprotein 2
Gene Name: EBLN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096508: 25%, ENSRNOG00000021903: 29%
Entrez Gene ID: 55096
Uniprot ID: Q6P2I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EBLN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096508: 25%, ENSRNOG00000021903: 29%
Entrez Gene ID: 55096
Uniprot ID: Q6P2I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAM |
| Documents & Links for Anti EBLN2 pAb (ATL-HPA068795) | |
| Datasheet | Anti EBLN2 pAb (ATL-HPA068795) Datasheet (External Link) |
| Vendor Page | Anti EBLN2 pAb (ATL-HPA068795) at Atlas |
| Documents & Links for Anti EBLN2 pAb (ATL-HPA068795) | |
| Datasheet | Anti EBLN2 pAb (ATL-HPA068795) Datasheet (External Link) |
| Vendor Page | Anti EBLN2 pAb (ATL-HPA068795) |