Protein Description: ELL associated factor 1
Gene Name: EAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021890: 96%, ENSRNOG00000019559: 91%
Entrez Gene ID: 85403
Uniprot ID: Q96JC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021890: 96%, ENSRNOG00000019559: 91%
Entrez Gene ID: 85403
Uniprot ID: Q96JC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRN |
| Documents & Links for Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation) | |
| Datasheet | Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation) at Atlas |
| Documents & Links for Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation) | |
| Datasheet | Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation) |