Anti E4F1 pAb (ATL-HPA072309)

Catalog No:
ATL-HPA072309-25
$447.00

Description

Product Description

Protein Description: E4F transcription factor 1
Gene Name: E4F1
Alternative Gene Name: E4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024137: 88%, ENSRNOG00000009224: 91%
Entrez Gene ID: 1877
Uniprot ID: Q66K89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECK
Gene Sequence VGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECK
Gene ID - Mouse ENSMUSG00000024137
Gene ID - Rat ENSRNOG00000009224
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti E4F1 pAb (ATL-HPA072309)
Datasheet Anti E4F1 pAb (ATL-HPA072309) Datasheet (External Link)
Vendor Page Anti E4F1 pAb (ATL-HPA072309) at Atlas Antibodies

Documents & Links for Anti E4F1 pAb (ATL-HPA072309)
Datasheet Anti E4F1 pAb (ATL-HPA072309) Datasheet (External Link)
Vendor Page Anti E4F1 pAb (ATL-HPA072309)

Product Description

Protein Description: E4F transcription factor 1
Gene Name: E4F1
Alternative Gene Name: E4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024137: 88%, ENSRNOG00000009224: 91%
Entrez Gene ID: 1877
Uniprot ID: Q66K89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECK
Gene Sequence VGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECK
Gene ID - Mouse ENSMUSG00000024137
Gene ID - Rat ENSRNOG00000009224
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti E4F1 pAb (ATL-HPA072309)
Datasheet Anti E4F1 pAb (ATL-HPA072309) Datasheet (External Link)
Vendor Page Anti E4F1 pAb (ATL-HPA072309) at Atlas Antibodies

Documents & Links for Anti E4F1 pAb (ATL-HPA072309)
Datasheet Anti E4F1 pAb (ATL-HPA072309) Datasheet (External Link)
Vendor Page Anti E4F1 pAb (ATL-HPA072309)