Protein Description: E4F transcription factor 1
Gene Name: E4F1
Alternative Gene Name: E4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024137: 77%, ENSRNOG00000009224: 79%
Entrez Gene ID: 1877
Uniprot ID: Q66K89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: E4F1
Alternative Gene Name: E4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024137: 77%, ENSRNOG00000009224: 79%
Entrez Gene ID: 1877
Uniprot ID: Q66K89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQM |
Documents & Links for Anti E4F1 pAb (ATL-HPA071325) | |
Datasheet | Anti E4F1 pAb (ATL-HPA071325) Datasheet (External Link) |
Vendor Page | Anti E4F1 pAb (ATL-HPA071325) at Atlas |
Documents & Links for Anti E4F1 pAb (ATL-HPA071325) | |
Datasheet | Anti E4F1 pAb (ATL-HPA071325) Datasheet (External Link) |
Vendor Page | Anti E4F1 pAb (ATL-HPA071325) |