Protein Description: E2F transcription factor 7
Gene Name: E2F7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020185: 87%, ENSRNOG00000026252: 88%
Entrez Gene ID: 144455
Uniprot ID: Q96AV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: E2F7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020185: 87%, ENSRNOG00000026252: 88%
Entrez Gene ID: 144455
Uniprot ID: Q96AV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKFTPERNPITPVKLVDRQQAEPW |
Documents & Links for Anti E2F7 pAb (ATL-HPA064866) | |
Datasheet | Anti E2F7 pAb (ATL-HPA064866) Datasheet (External Link) |
Vendor Page | Anti E2F7 pAb (ATL-HPA064866) at Atlas |
Documents & Links for Anti E2F7 pAb (ATL-HPA064866) | |
Datasheet | Anti E2F7 pAb (ATL-HPA064866) Datasheet (External Link) |
Vendor Page | Anti E2F7 pAb (ATL-HPA064866) |