Anti E2F5 pAb (ATL-HPA055723)

Atlas Antibodies

Catalog No: ATL-HPA055723-25

• 

Product Description

Protein Description: E2F transcription factor 5, p130-binding
Gene Name: E2F5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027552: 93%, ENSRNOG00000010760: 90%
Entrez Gene ID: 1875
Uniprot ID: Q15329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNL
• Gene Sequence: INLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNL
• Gene ID - Mouse: ENSMUSG00000027552
• Gene ID - Rat: ENSRNOG00000010760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.