Anti E2F3 pAb (ATL-HPA065012)

Atlas Antibodies

Catalog No: ATL-HPA065012-25

• 

Product Description

Protein Description: E2F transcription factor 3
Gene Name: E2F3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016477: 95%, ENSRNOG00000029273: 95%
Entrez Gene ID: 1871
Uniprot ID: O00716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLL
• Gene Sequence: TNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLL
• Gene ID - Mouse: ENSMUSG00000016477
• Gene ID - Rat: ENSRNOG00000029273
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.