Description
Product Description
Protein Description: E2F transcription factor 3
Gene Name: E2F3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016477: 95%, ENSRNOG00000029273: 95%
Entrez Gene ID: 1871
Uniprot ID: O00716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: E2F3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016477: 95%, ENSRNOG00000029273: 95%
Entrez Gene ID: 1871
Uniprot ID: O00716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLL |
Gene Sequence | TNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLL |
Gene ID - Mouse | ENSMUSG00000016477 |
Gene ID - Rat | ENSRNOG00000029273 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti E2F3 pAb (ATL-HPA065012) | |
Datasheet | Anti E2F3 pAb (ATL-HPA065012) Datasheet (External Link) |
Vendor Page | Anti E2F3 pAb (ATL-HPA065012) at Atlas Antibodies |
Documents & Links for Anti E2F3 pAb (ATL-HPA065012) | |
Datasheet | Anti E2F3 pAb (ATL-HPA065012) Datasheet (External Link) |
Vendor Page | Anti E2F3 pAb (ATL-HPA065012) |