Anti DZANK1 pAb (ATL-HPA064255)

Atlas Antibodies

Catalog No: ATL-HPA064255-25

• 
• 

Product Description

Protein Description: double zinc ribbon and ankyrin repeat domains 1
Gene Name: DZANK1
Alternative Gene Name: ANKRD64, bA189K21.8, C20orf12, C20orf84, dJ568F9.2, FLJ10600, FLJ30892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037259: 90%, ENSRNOG00000007440: 90%
Entrez Gene ID: 55184
Uniprot ID: Q9NVP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCE
• Gene Sequence: PGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCE
• Gene ID - Mouse: ENSMUSG00000037259
• Gene ID - Rat: ENSRNOG00000007440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.