Description
Product Description
Protein Description: dynein, cytoplasmic 2, light intermediate chain 1
Gene Name: DYNC2LI1
Alternative Gene Name: CGI-60, D2LIC, DKFZP564A033, LIC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024253: 82%, ENSRNOG00000005151: 86%
Entrez Gene ID: 51626
Uniprot ID: Q8TCX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DYNC2LI1
Alternative Gene Name: CGI-60, D2LIC, DKFZP564A033, LIC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024253: 82%, ENSRNOG00000005151: 86%
Entrez Gene ID: 51626
Uniprot ID: Q8TCX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL |
Gene Sequence | PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL |
Gene ID - Mouse | ENSMUSG00000024253 |
Gene ID - Rat | ENSRNOG00000005151 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DYNC2LI1 pAb (ATL-HPA062905) | |
Datasheet | Anti DYNC2LI1 pAb (ATL-HPA062905) Datasheet (External Link) |
Vendor Page | Anti DYNC2LI1 pAb (ATL-HPA062905) at Atlas Antibodies |
Documents & Links for Anti DYNC2LI1 pAb (ATL-HPA062905) | |
Datasheet | Anti DYNC2LI1 pAb (ATL-HPA062905) Datasheet (External Link) |
Vendor Page | Anti DYNC2LI1 pAb (ATL-HPA062905) |