![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/98963/178336/atl-hpa062905_anti-dync2li1-pab-atl-hpa062905_59998__18288.1681133757.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: dynein, cytoplasmic 2, light intermediate chain 1
Gene Name: DYNC2LI1
Alternative Gene Name: CGI-60, D2LIC, DKFZP564A033, LIC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024253: 82%, ENSRNOG00000005151: 86%
Entrez Gene ID: 51626
Uniprot ID: Q8TCX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DYNC2LI1
Alternative Gene Name: CGI-60, D2LIC, DKFZP564A033, LIC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024253: 82%, ENSRNOG00000005151: 86%
Entrez Gene ID: 51626
Uniprot ID: Q8TCX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL |
| Documents & Links for Anti DYNC2LI1 pAb (ATL-HPA062905) | |
| Datasheet | Anti DYNC2LI1 pAb (ATL-HPA062905) Datasheet (External Link) |
| Vendor Page | Anti DYNC2LI1 pAb (ATL-HPA062905) at Atlas |
| Documents & Links for Anti DYNC2LI1 pAb (ATL-HPA062905) | |
| Datasheet | Anti DYNC2LI1 pAb (ATL-HPA062905) Datasheet (External Link) |
| Vendor Page | Anti DYNC2LI1 pAb (ATL-HPA062905) |