Anti DVL3 pAb (ATL-HPA058265)

Atlas Antibodies

Catalog No: ATL-HPA058265-25

• 
• 
• 

Product Description

Protein Description: dishevelled segment polarity protein 3
Gene Name: DVL3
Alternative Gene Name: KIAA0208
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003233: 95%, ENSRNOG00000001708: 95%
Entrez Gene ID: 1857
Uniprot ID: Q92997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
• Gene Sequence: SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
• Gene ID - Mouse: ENSMUSG00000003233
• Gene ID - Rat: ENSRNOG00000001708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.