Description
Product Description
Protein Description: dishevelled segment polarity protein 3
Gene Name: DVL3
Alternative Gene Name: KIAA0208
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003233: 95%, ENSRNOG00000001708: 95%
Entrez Gene ID: 1857
Uniprot ID: Q92997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DVL3
Alternative Gene Name: KIAA0208
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003233: 95%, ENSRNOG00000001708: 95%
Entrez Gene ID: 1857
Uniprot ID: Q92997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP |
Gene Sequence | SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP |
Gene ID - Mouse | ENSMUSG00000003233 |
Gene ID - Rat | ENSRNOG00000001708 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DVL3 pAb (ATL-HPA058265) | |
Datasheet | Anti DVL3 pAb (ATL-HPA058265) Datasheet (External Link) |
Vendor Page | Anti DVL3 pAb (ATL-HPA058265) at Atlas Antibodies |
Documents & Links for Anti DVL3 pAb (ATL-HPA058265) | |
Datasheet | Anti DVL3 pAb (ATL-HPA058265) Datasheet (External Link) |
Vendor Page | Anti DVL3 pAb (ATL-HPA058265) |