Anti DVL1 pAb (ATL-HPA073607)

Atlas Antibodies

Catalog No: ATL-HPA073607-25

• 
• 

Product Description

Protein Description: dishevelled segment polarity protein 1
Gene Name: DVL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029071: 97%, ENSRNOG00000019423: 100%
Entrez Gene ID: 1855
Uniprot ID: O14640
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS
• Gene Sequence: PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS
• Gene ID - Mouse: ENSMUSG00000029071
• Gene ID - Rat: ENSRNOG00000019423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.