Anti DUSP7 pAb (ATL-HPA073007)

Atlas Antibodies

Catalog No: ATL-HPA073007-25

• 

Product Description

Protein Description: dual specificity phosphatase 7
Gene Name: DUSP7
Alternative Gene Name: MKP-X, PYST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053716: 100%, ENSRNOG00000010789: 100%
Entrez Gene ID: 1849
Uniprot ID: Q16829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
• Gene Sequence: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
• Gene ID - Mouse: ENSMUSG00000053716
• Gene ID - Rat: ENSRNOG00000010789
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.