Protein Description: dual specificity phosphatase 7
Gene Name: DUSP7
Alternative Gene Name: MKP-X, PYST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053716: 100%, ENSRNOG00000010789: 100%
Entrez Gene ID: 1849
Uniprot ID: Q16829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUSP7
Alternative Gene Name: MKP-X, PYST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053716: 100%, ENSRNOG00000010789: 100%
Entrez Gene ID: 1849
Uniprot ID: Q16829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET |
| Documents & Links for Anti DUSP7 pAb (ATL-HPA073007) | |
| Datasheet | Anti DUSP7 pAb (ATL-HPA073007) Datasheet (External Link) |
| Vendor Page | Anti DUSP7 pAb (ATL-HPA073007) at Atlas |
| Documents & Links for Anti DUSP7 pAb (ATL-HPA073007) | |
| Datasheet | Anti DUSP7 pAb (ATL-HPA073007) Datasheet (External Link) |
| Vendor Page | Anti DUSP7 pAb (ATL-HPA073007) |