Description
Product Description
Protein Description: dual specificity phosphatase 4
Gene Name: DUSP4
Alternative Gene Name: HVH2, MKP-2, TYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031530: 89%, ENSRNOG00000011921: 89%
Entrez Gene ID: 1846
Uniprot ID: Q13115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUSP4
Alternative Gene Name: HVH2, MKP-2, TYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031530: 89%, ENSRNOG00000011921: 89%
Entrez Gene ID: 1846
Uniprot ID: Q13115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS |
| Gene Sequence | QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS |
| Gene ID - Mouse | ENSMUSG00000031530 |
| Gene ID - Rat | ENSRNOG00000011921 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti DUSP4 pAb (ATL-HPA061967) | |
| Datasheet | Anti DUSP4 pAb (ATL-HPA061967) Datasheet (External Link) |
| Vendor Page | Anti DUSP4 pAb (ATL-HPA061967) at Atlas Antibodies |
| Documents & Links for Anti DUSP4 pAb (ATL-HPA061967) | |
| Datasheet | Anti DUSP4 pAb (ATL-HPA061967) Datasheet (External Link) |
| Vendor Page | Anti DUSP4 pAb (ATL-HPA061967) |