Protein Description: dual specificity phosphatase 3
Gene Name: DUSP3
Alternative Gene Name: VHR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003518: 94%, ENSRNOG00000036798: 88%
Entrez Gene ID: 1845
Uniprot ID: P51452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUSP3
Alternative Gene Name: VHR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003518: 94%, ENSRNOG00000036798: 88%
Entrez Gene ID: 1845
Uniprot ID: P51452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP |
| Documents & Links for Anti DUSP3 pAb (ATL-HPA063616) | |
| Datasheet | Anti DUSP3 pAb (ATL-HPA063616) Datasheet (External Link) |
| Vendor Page | Anti DUSP3 pAb (ATL-HPA063616) at Atlas |
| Documents & Links for Anti DUSP3 pAb (ATL-HPA063616) | |
| Datasheet | Anti DUSP3 pAb (ATL-HPA063616) Datasheet (External Link) |
| Vendor Page | Anti DUSP3 pAb (ATL-HPA063616) |