Description
Product Description
Protein Description: dual specificity phosphatase 2
Gene Name: DUSP2
Alternative Gene Name: PAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027368: 72%, ENSRNOG00000013862: 70%
Entrez Gene ID: 1844
Uniprot ID: Q05923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUSP2
Alternative Gene Name: PAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027368: 72%, ENSRNOG00000013862: 70%
Entrez Gene ID: 1844
Uniprot ID: Q05923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPV |
Gene Sequence | GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPV |
Gene ID - Mouse | ENSMUSG00000027368 |
Gene ID - Rat | ENSRNOG00000013862 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DUSP2 pAb (ATL-HPA071920) | |
Datasheet | Anti DUSP2 pAb (ATL-HPA071920) Datasheet (External Link) |
Vendor Page | Anti DUSP2 pAb (ATL-HPA071920) at Atlas Antibodies |
Documents & Links for Anti DUSP2 pAb (ATL-HPA071920) | |
Datasheet | Anti DUSP2 pAb (ATL-HPA071920) Datasheet (External Link) |
Vendor Page | Anti DUSP2 pAb (ATL-HPA071920) |