Description
Product Description
Protein Description: dual specificity phosphatase 15
Gene Name: DUSP15
Alternative Gene Name: bA243J16.5, bA243J16.6, C20orf57, FLJ20645, VHY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015461: 31%, ENSRNOG00000046776: 35%
Entrez Gene ID: 128853
Uniprot ID: Q9H1R2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUSP15
Alternative Gene Name: bA243J16.5, bA243J16.6, C20orf57, FLJ20645, VHY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015461: 31%, ENSRNOG00000046776: 35%
Entrez Gene ID: 128853
Uniprot ID: Q9H1R2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA |
Gene Sequence | ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA |
Gene ID - Mouse | ENSMUSG00000015461 |
Gene ID - Rat | ENSRNOG00000046776 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DUSP15 pAb (ATL-HPA076649 w/enhanced validation) | |
Datasheet | Anti DUSP15 pAb (ATL-HPA076649 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DUSP15 pAb (ATL-HPA076649 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DUSP15 pAb (ATL-HPA076649 w/enhanced validation) | |
Datasheet | Anti DUSP15 pAb (ATL-HPA076649 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DUSP15 pAb (ATL-HPA076649 w/enhanced validation) |