Protein Description: dual specificity phosphatase 1
Gene Name: DUSP1
Alternative Gene Name: CL100, HVH1, MKP-1, PTPN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024190: 94%, ENSRNOG00000003977: 96%
Entrez Gene ID: 1843
Uniprot ID: P28562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUSP1
Alternative Gene Name: CL100, HVH1, MKP-1, PTPN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024190: 94%, ENSRNOG00000003977: 96%
Entrez Gene ID: 1843
Uniprot ID: P28562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS |
| Documents & Links for Anti DUSP1 pAb (ATL-HPA069577) | |
| Datasheet | Anti DUSP1 pAb (ATL-HPA069577) Datasheet (External Link) |
| Vendor Page | Anti DUSP1 pAb (ATL-HPA069577) at Atlas |
| Documents & Links for Anti DUSP1 pAb (ATL-HPA069577) | |
| Datasheet | Anti DUSP1 pAb (ATL-HPA069577) Datasheet (External Link) |
| Vendor Page | Anti DUSP1 pAb (ATL-HPA069577) |