Description
Product Description
Protein Description: dual oxidase maturation factor 2
Gene Name: DUOXA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027225: 53%, ENSRNOG00000017805: 51%
Entrez Gene ID: 405753
Uniprot ID: Q1HG44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DUOXA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027225: 53%, ENSRNOG00000017805: 51%
Entrez Gene ID: 405753
Uniprot ID: Q1HG44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLQYVRPSALRTLLDQSAKDCSQERGGSPLILGDPLHKQAALPDLKCITTNL |
Gene Sequence | SLQYVRPSALRTLLDQSAKDCSQERGGSPLILGDPLHKQAALPDLKCITTNL |
Gene ID - Mouse | ENSMUSG00000027225 |
Gene ID - Rat | ENSRNOG00000017805 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DUOXA2 pAb (ATL-HPA063548 w/enhanced validation) | |
Datasheet | Anti DUOXA2 pAb (ATL-HPA063548 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DUOXA2 pAb (ATL-HPA063548 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DUOXA2 pAb (ATL-HPA063548 w/enhanced validation) | |
Datasheet | Anti DUOXA2 pAb (ATL-HPA063548 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DUOXA2 pAb (ATL-HPA063548 w/enhanced validation) |