Protein Description: DSN1 homolog, MIS12 kinetochore complex component
Gene Name: DSN1
Alternative Gene Name: C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027635: 76%, ENSRNOG00000006236: 76%
Entrez Gene ID: 79980
Uniprot ID: Q9H410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DSN1
Alternative Gene Name: C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027635: 76%, ENSRNOG00000006236: 76%
Entrez Gene ID: 79980
Uniprot ID: Q9H410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQ |
| Gene ID - Mouse | ENSMUSG00000027635 |
| Gene ID - Rat | ENSMUSG00000027635 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSN1 pAb (ATL-HPA030627) | |
| Datasheet | Anti DSN1 pAb (ATL-HPA030627) Datasheet (External Link) |
| Vendor Page | Anti DSN1 pAb (ATL-HPA030627) at Atlas |
| Documents & Links for Anti DSN1 pAb (ATL-HPA030627) | |
| Datasheet | Anti DSN1 pAb (ATL-HPA030627) Datasheet (External Link) |
| Vendor Page | Anti DSN1 pAb (ATL-HPA030627) |