Description
Product Description
Protein Description: desmoglein 4
Gene Name: DSG4
Alternative Gene Name: CDHF13, LAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001804: 77%, ENSRNOG00000022364: 77%
Entrez Gene ID: 147409
Uniprot ID: Q86SJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DSG4
Alternative Gene Name: CDHF13, LAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001804: 77%, ENSRNOG00000022364: 77%
Entrez Gene ID: 147409
Uniprot ID: Q86SJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP |
Gene Sequence | DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP |
Gene ID - Mouse | ENSMUSG00000001804 |
Gene ID - Rat | ENSRNOG00000022364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DSG4 pAb (ATL-HPA059456) | |
Datasheet | Anti DSG4 pAb (ATL-HPA059456) Datasheet (External Link) |
Vendor Page | Anti DSG4 pAb (ATL-HPA059456) at Atlas Antibodies |
Documents & Links for Anti DSG4 pAb (ATL-HPA059456) | |
Datasheet | Anti DSG4 pAb (ATL-HPA059456) Datasheet (External Link) |
Vendor Page | Anti DSG4 pAb (ATL-HPA059456) |