Anti DSG4 pAb (ATL-HPA059456)

Catalog No:
ATL-HPA059456-25
$447.00

Description

Product Description

Protein Description: desmoglein 4
Gene Name: DSG4
Alternative Gene Name: CDHF13, LAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001804: 77%, ENSRNOG00000022364: 77%
Entrez Gene ID: 147409
Uniprot ID: Q86SJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP
Gene Sequence DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP
Gene ID - Mouse ENSMUSG00000001804
Gene ID - Rat ENSRNOG00000022364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DSG4 pAb (ATL-HPA059456)
Datasheet Anti DSG4 pAb (ATL-HPA059456) Datasheet (External Link)
Vendor Page Anti DSG4 pAb (ATL-HPA059456) at Atlas Antibodies

Documents & Links for Anti DSG4 pAb (ATL-HPA059456)
Datasheet Anti DSG4 pAb (ATL-HPA059456) Datasheet (External Link)
Vendor Page Anti DSG4 pAb (ATL-HPA059456)

Product Description

Protein Description: desmoglein 4
Gene Name: DSG4
Alternative Gene Name: CDHF13, LAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001804: 77%, ENSRNOG00000022364: 77%
Entrez Gene ID: 147409
Uniprot ID: Q86SJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP
Gene Sequence DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP
Gene ID - Mouse ENSMUSG00000001804
Gene ID - Rat ENSRNOG00000022364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DSG4 pAb (ATL-HPA059456)
Datasheet Anti DSG4 pAb (ATL-HPA059456) Datasheet (External Link)
Vendor Page Anti DSG4 pAb (ATL-HPA059456) at Atlas Antibodies

Documents & Links for Anti DSG4 pAb (ATL-HPA059456)
Datasheet Anti DSG4 pAb (ATL-HPA059456) Datasheet (External Link)
Vendor Page Anti DSG4 pAb (ATL-HPA059456)