Description
Product Description
Protein Description: desmoglein 3
Gene Name: DSG3
Alternative Gene Name: CDHF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056632: 80%, ENSRNOG00000016632: 81%
Entrez Gene ID: 1830
Uniprot ID: P32926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DSG3
Alternative Gene Name: CDHF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056632: 80%, ENSRNOG00000016632: 81%
Entrez Gene ID: 1830
Uniprot ID: P32926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFND |
Gene Sequence | FRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFND |
Gene ID - Mouse | ENSMUSG00000056632 |
Gene ID - Rat | ENSRNOG00000016632 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DSG3 pAb (ATL-HPA056863 w/enhanced validation) | |
Datasheet | Anti DSG3 pAb (ATL-HPA056863 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DSG3 pAb (ATL-HPA056863 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DSG3 pAb (ATL-HPA056863 w/enhanced validation) | |
Datasheet | Anti DSG3 pAb (ATL-HPA056863 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DSG3 pAb (ATL-HPA056863 w/enhanced validation) |