Protein Description: desmocollin 3
Gene Name: DSC3
Alternative Gene Name: CDHF3, DSC, DSC1, DSC2, DSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059898: 73%, ENSRNOG00000017159: 68%
Entrez Gene ID: 1825
Uniprot ID: Q14574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DSC3
Alternative Gene Name: CDHF3, DSC, DSC1, DSC2, DSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059898: 73%, ENSRNOG00000017159: 68%
Entrez Gene ID: 1825
Uniprot ID: Q14574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET |
| Documents & Links for Anti DSC3 pAb (ATL-HPA073937) | |
| Datasheet | Anti DSC3 pAb (ATL-HPA073937) Datasheet (External Link) |
| Vendor Page | Anti DSC3 pAb (ATL-HPA073937) at Atlas |
| Documents & Links for Anti DSC3 pAb (ATL-HPA073937) | |
| Datasheet | Anti DSC3 pAb (ATL-HPA073937) Datasheet (External Link) |
| Vendor Page | Anti DSC3 pAb (ATL-HPA073937) |