Protein Description: desmocollin 1
Gene Name: DSC1
Alternative Gene Name: CDHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044322: 80%, ENSRNOG00000056258: 77%
Entrez Gene ID: 1823
Uniprot ID: Q08554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DSC1
Alternative Gene Name: CDHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044322: 80%, ENSRNOG00000056258: 77%
Entrez Gene ID: 1823
Uniprot ID: Q08554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG |
Documents & Links for Anti DSC1 pAb (ATL-HPA075379 w/enhanced validation) | |
Datasheet | Anti DSC1 pAb (ATL-HPA075379 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DSC1 pAb (ATL-HPA075379 w/enhanced validation) at Atlas |
Documents & Links for Anti DSC1 pAb (ATL-HPA075379 w/enhanced validation) | |
Datasheet | Anti DSC1 pAb (ATL-HPA075379 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DSC1 pAb (ATL-HPA075379 w/enhanced validation) |