![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/83708/152407/atl-hpa017304_anti-drd1-pab-atl-hpa017304_34036__60264.1681102360.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: dopamine receptor D1
Gene Name: DRD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021478: 89%, ENSRNOG00000023688: 90%
Entrez Gene ID: 1812
Uniprot ID: P21728
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DRD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021478: 89%, ENSRNOG00000023688: 90%
Entrez Gene ID: 1812
Uniprot ID: P21728
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP |
| Documents & Links for Anti DRD1 pAb (ATL-HPA017304) | |
| Datasheet | Anti DRD1 pAb (ATL-HPA017304) Datasheet (External Link) |
| Vendor Page | Anti DRD1 pAb (ATL-HPA017304) at Atlas |
| Documents & Links for Anti DRD1 pAb (ATL-HPA017304) | |
| Datasheet | Anti DRD1 pAb (ATL-HPA017304) Datasheet (External Link) |
| Vendor Page | Anti DRD1 pAb (ATL-HPA017304) |