Protein Description: dihydropyrimidinase-like 5
Gene Name: DPYSL5
Alternative Gene Name: CRAM, CRMP-5, CRMP5, Ulip6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029168: 99%, ENSRNOG00000054165: 99%
Entrez Gene ID: 56896
Uniprot ID: Q9BPU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPYSL5
Alternative Gene Name: CRAM, CRMP-5, CRMP5, Ulip6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029168: 99%, ENSRNOG00000054165: 99%
Entrez Gene ID: 56896
Uniprot ID: Q9BPU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDH |
| Documents & Links for Anti DPYSL5 pAb (ATL-HPA072387) | |
| Datasheet | Anti DPYSL5 pAb (ATL-HPA072387) Datasheet (External Link) |
| Vendor Page | Anti DPYSL5 pAb (ATL-HPA072387) at Atlas |
| Documents & Links for Anti DPYSL5 pAb (ATL-HPA072387) | |
| Datasheet | Anti DPYSL5 pAb (ATL-HPA072387) Datasheet (External Link) |
| Vendor Page | Anti DPYSL5 pAb (ATL-HPA072387) |
| Citations for Anti DPYSL5 pAb (ATL-HPA072387) – 1 Found |
| Park, Min Gi; Seo, Sunyoung; Ham, Seok Won; Choi, Sang-Hun; Kim, Hyunggee. Dihydropyrimidinase-related protein 5 controls glioblastoma stem cell characteristics as a biomarker of proneural-subtype glioblastoma stem cells. Oncology Letters. 2020;20(2):1153-1162. PubMed |