Protein Description: dpy-19-like 2 (C. elegans)
Gene Name: DPY19L2
Alternative Gene Name: FLJ32949, SPATA34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063952: 37%, ENSRNOG00000028641: 37%
Entrez Gene ID: 283417
Uniprot ID: Q6NUT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPY19L2
Alternative Gene Name: FLJ32949, SPATA34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063952: 37%, ENSRNOG00000028641: 37%
Entrez Gene ID: 283417
Uniprot ID: Q6NUT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM |
Documents & Links for Anti DPY19L2 pAb (ATL-HPA071264) | |
Datasheet | Anti DPY19L2 pAb (ATL-HPA071264) Datasheet (External Link) |
Vendor Page | Anti DPY19L2 pAb (ATL-HPA071264) at Atlas |
Documents & Links for Anti DPY19L2 pAb (ATL-HPA071264) | |
Datasheet | Anti DPY19L2 pAb (ATL-HPA071264) Datasheet (External Link) |
Vendor Page | Anti DPY19L2 pAb (ATL-HPA071264) |