![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100745/180708/atl-hpa071236_anti-dpp4-pab-atl-hpa071236-wenhanced-validation_62376__32756.1681136862.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: dipeptidyl peptidase 4
Gene Name: DPP4
Alternative Gene Name: ADCP2, CD26, DPPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035000: 75%, ENSRNOG00000030763: 69%
Entrez Gene ID: 1803
Uniprot ID: P27487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPP4
Alternative Gene Name: ADCP2, CD26, DPPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035000: 75%, ENSRNOG00000030763: 69%
Entrez Gene ID: 1803
Uniprot ID: P27487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLY |
| Documents & Links for Anti DPP4 pAb (ATL-HPA071236 w/enhanced validation) | |
| Datasheet | Anti DPP4 pAb (ATL-HPA071236 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DPP4 pAb (ATL-HPA071236 w/enhanced validation) at Atlas |
| Documents & Links for Anti DPP4 pAb (ATL-HPA071236 w/enhanced validation) | |
| Datasheet | Anti DPP4 pAb (ATL-HPA071236 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DPP4 pAb (ATL-HPA071236 w/enhanced validation) |