Protein Description: dipeptidyl peptidase 4
Gene Name: DPP4
Alternative Gene Name: ADCP2, CD26, DPPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035000: 83%, ENSRNOG00000030763: 83%
Entrez Gene ID: 1803
Uniprot ID: P27487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPP4
Alternative Gene Name: ADCP2, CD26, DPPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035000: 83%, ENSRNOG00000030763: 83%
Entrez Gene ID: 1803
Uniprot ID: P27487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP |
Documents & Links for Anti DPP4 pAb (ATL-HPA068778) | |
Datasheet | Anti DPP4 pAb (ATL-HPA068778) Datasheet (External Link) |
Vendor Page | Anti DPP4 pAb (ATL-HPA068778) at Atlas |
Documents & Links for Anti DPP4 pAb (ATL-HPA068778) | |
Datasheet | Anti DPP4 pAb (ATL-HPA068778) Datasheet (External Link) |
Vendor Page | Anti DPP4 pAb (ATL-HPA068778) |