Anti DPM2 pAb (ATL-HPA064623)

Atlas Antibodies

Catalog No: ATL-HPA064623-25

• 

Product Description

Protein Description: dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Name: DPM2
Alternative Gene Name: MGC111193, MGC21559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040857: 38%, ENSRNOG00000020426: 38%
Entrez Gene ID: 8818
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPPPLDPGQGFGKTPPLNMLPHFGGAGSCLPRTHPWGFPVHPSRLPVSNLWVSWC
• Gene Sequence: SSPPPLDPGQGFGKTPPLNMLPHFGGAGSCLPRTHPWGFPVHPSRLPVSNLWVSWC
• Gene ID - Mouse: ENSMUSG00000040857
• Gene ID - Rat: ENSRNOG00000020426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.