Protein Description: diphthamide biosynthesis 5
Gene Name: DPH5
Alternative Gene Name: CGI-30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033554: 94%, ENSRNOG00000013719: 95%
Entrez Gene ID: 51611
Uniprot ID: Q9H2P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPH5
Alternative Gene Name: CGI-30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033554: 94%, ENSRNOG00000013719: 95%
Entrez Gene ID: 51611
Uniprot ID: Q9H2P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS |
Documents & Links for Anti DPH5 pAb (ATL-HPA076234) | |
Datasheet | Anti DPH5 pAb (ATL-HPA076234) Datasheet (External Link) |
Vendor Page | Anti DPH5 pAb (ATL-HPA076234) at Atlas |
Documents & Links for Anti DPH5 pAb (ATL-HPA076234) | |
Datasheet | Anti DPH5 pAb (ATL-HPA076234) Datasheet (External Link) |
Vendor Page | Anti DPH5 pAb (ATL-HPA076234) |