Protein Description: diphthamide biosynthesis 1
Gene Name: DPH1
Alternative Gene Name: DPH2L, DPH2L1, OVCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078789: 92%, ENSRNOG00000003116: 92%
Entrez Gene ID: 1801
Uniprot ID: Q9BZG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPH1
Alternative Gene Name: DPH2L, DPH2L1, OVCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078789: 92%, ENSRNOG00000003116: 92%
Entrez Gene ID: 1801
Uniprot ID: Q9BZG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK |
Documents & Links for Anti DPH1 pAb (ATL-HPA069750) | |
Datasheet | Anti DPH1 pAb (ATL-HPA069750) Datasheet (External Link) |
Vendor Page | Anti DPH1 pAb (ATL-HPA069750) at Atlas |
Documents & Links for Anti DPH1 pAb (ATL-HPA069750) | |
Datasheet | Anti DPH1 pAb (ATL-HPA069750) Datasheet (External Link) |
Vendor Page | Anti DPH1 pAb (ATL-HPA069750) |