Protein Description: dopey family member 2
Gene Name: DOPEY2
Alternative Gene Name: C21orf5, KIAA0933
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022946: 87%, ENSRNOG00000051204: 86%
Entrez Gene ID: 9980
Uniprot ID: Q9Y3R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOPEY2
Alternative Gene Name: C21orf5, KIAA0933
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022946: 87%, ENSRNOG00000051204: 86%
Entrez Gene ID: 9980
Uniprot ID: Q9Y3R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PANLRNARNAILEELPRTVNTMALLWNVLRKEETQKRPVDLLGATKGSSSVYFKTTKTIRQKILDFLNPLTAHLGVQLTAAVAAVWSRKKAQRHSKMKI |
| Documents & Links for Anti DOPEY2 pAb (ATL-HPA072065) | |
| Datasheet | Anti DOPEY2 pAb (ATL-HPA072065) Datasheet (External Link) |
| Vendor Page | Anti DOPEY2 pAb (ATL-HPA072065) at Atlas |
| Documents & Links for Anti DOPEY2 pAb (ATL-HPA072065) | |
| Datasheet | Anti DOPEY2 pAb (ATL-HPA072065) Datasheet (External Link) |
| Vendor Page | Anti DOPEY2 pAb (ATL-HPA072065) |