Protein Description: docking protein 6
Gene Name: DOK6
Alternative Gene Name: DOK5L, HsT3226, MGC20785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073514: 100%, ENSRNOG00000038190: 100%
Entrez Gene ID: 220164
Uniprot ID: Q6PKX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOK6
Alternative Gene Name: DOK5L, HsT3226, MGC20785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073514: 100%, ENSRNOG00000038190: 100%
Entrez Gene ID: 220164
Uniprot ID: Q6PKX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYW |
Documents & Links for Anti DOK6 pAb (ATL-HPA063534) | |
Datasheet | Anti DOK6 pAb (ATL-HPA063534) Datasheet (External Link) |
Vendor Page | Anti DOK6 pAb (ATL-HPA063534) at Atlas |
Documents & Links for Anti DOK6 pAb (ATL-HPA063534) | |
Datasheet | Anti DOK6 pAb (ATL-HPA063534) Datasheet (External Link) |
Vendor Page | Anti DOK6 pAb (ATL-HPA063534) |