Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)

Catalog No:
ATL-HPA077312-25
$447.00

Description

Product Description

Protein Description: docking protein 3
Gene Name: DOK3
Alternative Gene Name: FLJ22570
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035711: 70%, ENSRNOG00000013564: 70%
Entrez Gene ID: 79930
Uniprot ID: Q7L591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
Gene Sequence SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
Gene ID - Mouse ENSMUSG00000035711
Gene ID - Rat ENSRNOG00000013564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)
Datasheet Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)
Datasheet Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)

Citations

Citations for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) – 1 Found
Ochiai, Ryosuke; Hayashi, Kentaro; Yamamoto, Hiroshi; Fujii, Risa; Saichi, Naomi; Shinchi, Hiroki; Ishida, Tsuyoshi; Honda, Takeshi; Shimizu, Tetsuo; Matsutani, Noriyuki; Seki, Nobuhiko; Kawamura, Masafumi; Ueda, Koji. Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment. Cancer Science. 2022;113(11):3960-3971.  PubMed

Product Description

Protein Description: docking protein 3
Gene Name: DOK3
Alternative Gene Name: FLJ22570
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035711: 70%, ENSRNOG00000013564: 70%
Entrez Gene ID: 79930
Uniprot ID: Q7L591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
Gene Sequence SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
Gene ID - Mouse ENSMUSG00000035711
Gene ID - Rat ENSRNOG00000013564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)
Datasheet Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)
Datasheet Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation)

Citations

Citations for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) – 1 Found
Ochiai, Ryosuke; Hayashi, Kentaro; Yamamoto, Hiroshi; Fujii, Risa; Saichi, Naomi; Shinchi, Hiroki; Ishida, Tsuyoshi; Honda, Takeshi; Shimizu, Tetsuo; Matsutani, Noriyuki; Seki, Nobuhiko; Kawamura, Masafumi; Ueda, Koji. Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment. Cancer Science. 2022;113(11):3960-3971.  PubMed