Protein Description: docking protein 3
Gene Name: DOK3
Alternative Gene Name: FLJ22570
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035711: 70%, ENSRNOG00000013564: 70%
Entrez Gene ID: 79930
Uniprot ID: Q7L591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOK3
Alternative Gene Name: FLJ22570
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035711: 70%, ENSRNOG00000013564: 70%
Entrez Gene ID: 79930
Uniprot ID: Q7L591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER |
| Documents & Links for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) | |
| Datasheet | Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) at Atlas |
| Documents & Links for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) | |
| Datasheet | Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) |
| Citations for Anti DOK3 pAb (ATL-HPA077312 w/enhanced validation) – 1 Found |
| Ochiai, Ryosuke; Hayashi, Kentaro; Yamamoto, Hiroshi; Fujii, Risa; Saichi, Naomi; Shinchi, Hiroki; Ishida, Tsuyoshi; Honda, Takeshi; Shimizu, Tetsuo; Matsutani, Noriyuki; Seki, Nobuhiko; Kawamura, Masafumi; Ueda, Koji. Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment. Cancer Science. 2022;113(11):3960-3971. PubMed |