Protein Description: docking protein 2
Gene Name: DOK2
Alternative Gene Name: Dok-2, p56dok-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022102: 66%, ENSRNOG00000013922: 66%
Entrez Gene ID: 9046
Uniprot ID: O60496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOK2
Alternative Gene Name: Dok-2, p56dok-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022102: 66%, ENSRNOG00000013922: 66%
Entrez Gene ID: 9046
Uniprot ID: O60496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK |
Gene ID - Mouse | ENSMUSG00000022102 |
Gene ID - Rat | ENSMUSG00000022102 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) | |
Datasheet | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) at Atlas |
Documents & Links for Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) | |
Datasheet | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) |