Protein Description: docking protein 2
Gene Name: DOK2
Alternative Gene Name: Dok-2, p56dok-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022102: 66%, ENSRNOG00000013922: 66%
Entrez Gene ID: 9046
Uniprot ID: O60496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOK2
Alternative Gene Name: Dok-2, p56dok-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022102: 66%, ENSRNOG00000013922: 66%
Entrez Gene ID: 9046
Uniprot ID: O60496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK |
| Documents & Links for Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) | |
| Datasheet | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) at Atlas |
| Documents & Links for Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) | |
| Datasheet | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DOK2 pAb (ATL-HPA066571 w/enhanced validation) |