Protein Description: deoxyhypusine hydroxylase
Gene Name: DOHH
Alternative Gene Name: HLRC1, MGC4293
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078440: 81%, ENSRNOG00000004259: 83%
Entrez Gene ID: 83475
Uniprot ID: Q9BU89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOHH
Alternative Gene Name: HLRC1, MGC4293
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078440: 81%, ENSRNOG00000004259: 83%
Entrez Gene ID: 83475
Uniprot ID: Q9BU89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TENPMVRHECAEALGAIAQPACLAALQAHADDPERVVRESCEVALDMYEHETG |
| Documents & Links for Anti DOHH pAb (ATL-HPA076271) | |
| Datasheet | Anti DOHH pAb (ATL-HPA076271) Datasheet (External Link) |
| Vendor Page | Anti DOHH pAb (ATL-HPA076271) at Atlas |
| Documents & Links for Anti DOHH pAb (ATL-HPA076271) | |
| Datasheet | Anti DOHH pAb (ATL-HPA076271) Datasheet (External Link) |
| Vendor Page | Anti DOHH pAb (ATL-HPA076271) |