Anti DOHH pAb (ATL-HPA076271)

Atlas Antibodies

Catalog No: ATL-HPA076271-25

• 

Product Description

Protein Description: deoxyhypusine hydroxylase
Gene Name: DOHH
Alternative Gene Name: HLRC1, MGC4293
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078440: 81%, ENSRNOG00000004259: 83%
Entrez Gene ID: 83475
Uniprot ID: Q9BU89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TENPMVRHECAEALGAIAQPACLAALQAHADDPERVVRESCEVALDMYEHETG
• Gene Sequence: TENPMVRHECAEALGAIAQPACLAALQAHADDPERVVRESCEVALDMYEHETG
• Gene ID - Mouse: ENSMUSG00000078440
• Gene ID - Rat: ENSRNOG00000004259
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.