Protein Description: dedicator of cytokinesis 4
Gene Name: DOCK4
Alternative Gene Name: FLJ34238, KIAA0716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035954: 100%, ENSRNOG00000004823: 100%
Entrez Gene ID: 9732
Uniprot ID: Q8N1I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOCK4
Alternative Gene Name: FLJ34238, KIAA0716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035954: 100%, ENSRNOG00000004823: 100%
Entrez Gene ID: 9732
Uniprot ID: Q8N1I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISP |
| Documents & Links for Anti DOCK4 pAb (ATL-HPA071516) | |
| Datasheet | Anti DOCK4 pAb (ATL-HPA071516) Datasheet (External Link) |
| Vendor Page | Anti DOCK4 pAb (ATL-HPA071516) at Atlas |
| Documents & Links for Anti DOCK4 pAb (ATL-HPA071516) | |
| Datasheet | Anti DOCK4 pAb (ATL-HPA071516) Datasheet (External Link) |
| Vendor Page | Anti DOCK4 pAb (ATL-HPA071516) |