Protein Description: DNA (cytosine-5-)-methyltransferase 3-like
Gene Name: DNMT3L
Alternative Gene Name: MGC1090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000730: 63%, ENSRNOG00000001212: 66%
Entrez Gene ID: 29947
Uniprot ID: Q9UJW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNMT3L
Alternative Gene Name: MGC1090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000730: 63%, ENSRNOG00000001212: 66%
Entrez Gene ID: 29947
Uniprot ID: Q9UJW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVL |
Documents & Links for Anti DNMT3L pAb (ATL-HPA066780) | |
Datasheet | Anti DNMT3L pAb (ATL-HPA066780) Datasheet (External Link) |
Vendor Page | Anti DNMT3L pAb (ATL-HPA066780) at Atlas |
Documents & Links for Anti DNMT3L pAb (ATL-HPA066780) | |
Datasheet | Anti DNMT3L pAb (ATL-HPA066780) Datasheet (External Link) |
Vendor Page | Anti DNMT3L pAb (ATL-HPA066780) |