Description
Product Description
Protein Description: DNL-type zinc finger
Gene Name: DNLZ
Alternative Gene Name: bA413M3.2, C9orf151, HEP, RP11-413M3.2, TIMM15, ZIM17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075467: 64%, ENSRNOG00000018791: 70%
Entrez Gene ID: 728489
Uniprot ID: Q5SXM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNLZ
Alternative Gene Name: bA413M3.2, C9orf151, HEP, RP11-413M3.2, TIMM15, ZIM17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075467: 64%, ENSRNOG00000018791: 70%
Entrez Gene ID: 728489
Uniprot ID: Q5SXM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE |
| Gene Sequence | LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE |
| Gene ID - Mouse | ENSMUSG00000075467 |
| Gene ID - Rat | ENSRNOG00000018791 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti DNLZ pAb (ATL-HPA062738) | |
| Datasheet | Anti DNLZ pAb (ATL-HPA062738) Datasheet (External Link) |
| Vendor Page | Anti DNLZ pAb (ATL-HPA062738) at Atlas Antibodies |
| Documents & Links for Anti DNLZ pAb (ATL-HPA062738) | |
| Datasheet | Anti DNLZ pAb (ATL-HPA062738) Datasheet (External Link) |
| Vendor Page | Anti DNLZ pAb (ATL-HPA062738) |