Protein Description: deoxyribonuclease II, lysosomal
Gene Name: DNASE2
Alternative Gene Name: DNL, DNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003812: 59%, ENSRNOG00000023830: 60%
Entrez Gene ID: 1777
Uniprot ID: O00115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNASE2
Alternative Gene Name: DNL, DNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003812: 59%, ENSRNOG00000023830: 60%
Entrez Gene ID: 1777
Uniprot ID: O00115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR |
| Documents & Links for Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) | |
| Datasheet | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) at Atlas |
| Documents & Links for Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) | |
| Datasheet | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) |