Protein Description: deoxyribonuclease II, lysosomal
Gene Name: DNASE2
Alternative Gene Name: DNL, DNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003812: 59%, ENSRNOG00000023830: 60%
Entrez Gene ID: 1777
Uniprot ID: O00115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNASE2
Alternative Gene Name: DNL, DNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003812: 59%, ENSRNOG00000023830: 60%
Entrez Gene ID: 1777
Uniprot ID: O00115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR |
Documents & Links for Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) | |
Datasheet | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) at Atlas |
Documents & Links for Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) | |
Datasheet | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNASE2 pAb (ATL-HPA066185 w/enhanced validation) |